PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK28495.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family WRKY
Protein Properties Length: 298aa    MW: 33245.2 Da    PI: 7.0177
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK28495.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.24e-34151208259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp+vv++tYeg+Hnh+
  KFK28495.1 151 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQRCNVKKRVERSFQDPTVVITTYEGQHNHP 208
                 8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381306.6E-1071298IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.801.1E-35135210IPR003657WRKY domain
SuperFamilySSF1182901.11E-29142210IPR003657WRKY domain
PROSITE profilePS5081132.856145210IPR003657WRKY domain
SMARTSM007741.8E-39150209IPR003657WRKY domain
PfamPF031062.1E-26151208IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MNVPNNSYAN ISSQNGFDPS SNYSFTDCLQ SSPRDYESIL QKTFGLSPSS SEVFNSSIDQ  60
EPNREVTNDV INGGATTETP TRVSASSSSS EADHPGEDSG KSRRKRELVV GDGGEDDQSS  120
KKVVKTKKNE EKKQREPRVS FMTKSEVDHL EDGYRWRKYG QKAVKNSPYP RSYYRCTTQR  180
CNVKKRVERS FQDPTVVITT YEGQHNHPIP TNLRGSSAAA AMFSGDFMTP RSFAHEMFRN  240
SAYTNGGGAV AAALDHGYGQ SEYGSVNANP TSHQEYHHGG EYELLREIFP SIFFKQEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-29141210877Probable WRKY transcription factor 4
1wj2_A1e-29141210877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00440DAPTransfer from AT4G18170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002870066.11e-177WRKY DNA-binding protein 28
SwissprotQ8VWJ21e-175WRK28_ARATH; Probable WRKY transcription factor 28
TrEMBLA0A087GF430.0A0A087GF43_ARAAL; Uncharacterized protein
STRINGfgenesh2_kg.7__2483__AT4G18170.11e-176(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15242693
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.11e-167WRKY DNA-binding protein 28